PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10026520m
Common NameCICLE_v10026472mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family DBB
Protein Properties Length: 203aa    MW: 22646.3 Da    PI: 8.1722
Description DBB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10026520mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box26.11.7e-08442537
         zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......H 37
                      C+ +e   ++lfC  ++  lC++C l+eH +      H
  Ciclev10026520m  4 LCDVCEATAATLFCPADEAALCASCDLKEHMNnklassH 42
                     7******99*********************664666663 PP

2zf-B_box24.55.8e-085487538
         zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkgHt 38
                     kC++++++++ lfCe+ ++++C +C +  H gH 
  Ciclev10026520m 54 KCDLCDREKAFLFCEKGGMCICLTCDMVFHIGHP 87
                     8*****************************8896 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.552150IPR000315B-box-type zinc finger
CDDcd000215.87E-6333No hitNo description
PfamPF006431.0E-5334IPR000315B-box-type zinc finger
SMARTSM003367.6E-7447IPR000315B-box-type zinc finger
Gene3DG3DSA:4.10.45.104.8E-41435IPR000315B-box-type zinc finger
SuperFamilySSF578451.56E-54890No hitNo description
PROSITE profilePS501198.8875091IPR000315B-box-type zinc finger
SMARTSM003361.8E-65091IPR000315B-box-type zinc finger
PfamPF006438.7E-75387IPR000315B-box-type zinc finger
CDDcd000219.65E-75491No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MQILCDVCEA TAATLFCPAD EAALCASCDL KEHMNNKLAS SHVRHDLPPS SFGKCDLCDR  60
EKAFLFCEKG GMCICLTCDM VFHIGHPRFL VMSQKIQFPV EDPIWGKPIS RPLNQAEIKK  120
EQNDPLEMTI GEDQQNHKVF PTAVADVRAT SKAKRGNKMI DLNRKPRNPK AAAPKYKKKQ  180
TIDLKALLAL ECQTSNHHLQ FP*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ccl.209960.0flower
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006425536.11e-150hypothetical protein CICLE_v10026472mg
RefseqXP_006466912.11e-150PREDICTED: B-box zinc finger protein 18-like isoform X3
TrEMBLV4SNY01e-150V4SNY0_9R
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38960.17e-34DBB family protein